PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK01852.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 305aa    MW: 34834.1 Da    PI: 4.6355
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK01852.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS213.79.7e-662129776350
       GRAS  76 eelaalklfsevsPilkfshltaNqaIleavege.ervHiiDfdisqGlQWpaLlqaLasRpeg..........ppslRiTgvgspesgskeeleetger 164
                +++ +++  ++  P++++ h+ a qaI e++++  +++H+iD++i  G+QW  L++aLa+R+++             l+iT++g pe  ++ ++eet++r
  PK01852.1  21 TSILSVT-CFQRLPFPQVLHFPAVQAIIESLDEFdDKLHVIDLEIRSGVQWTLLMKALAERNDNnninnqdrplFQLLKITAIGTPE--NQVKIEETQNR 117
                3344444.44567********************9899*************************4445666665444589*******88..99********* PP

       GRAS 165 LakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyy 264
                L+++Ae+l+vpf+f++l+ ++l+d++  +++++++E+laV  +l l  +l +++sle+    +++++k+l+P v+vv+e e+++n++sF++rf+eal +y
  PK01852.1 118 LTNLAESLNVPFSFKILILTELDDINEGMIETEEDEVLAVFTSLLLRMMLYKPLSLEK----LMRVIKTLKPSVMVVIETEVNLNAPSFANRFIEALFFY 213
                **********************************************************....************************************** PP

       GRAS 265 salfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyr 350
                 a+fd++e+ + +e+e ++++E++ lg  i n+v++e+ er+ r  + + Wr+ +e++ + + +ls++   qa+l+ +k++  g +
  PK01852.1 214 GAFFDCFETCFKEEEELKTTMEEV-LGMGIDNIVSKENGERVIRSVRIGVWRAFFERFRMVESKLSDSSLYQASLVAKKFG-YGSS 297
                ***********************9.****************************************************9998.3333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098534.5261302IPR005202Transcription factor GRAS
PfamPF035143.4E-6321297IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MTSTTNTTNN DKDQLSRGLG TSILSVTCFQ RLPFPQVLHF PAVQAIIESL DEFDDKLHVI  60
DLEIRSGVQW TLLMKALAER NDNNNINNQD RPLFQLLKIT AIGTPENQVK IEETQNRLTN  120
LAESLNVPFS FKILILTELD DINEGMIETE EDEVLAVFTS LLLRMMLYKP LSLEKLMRVI  180
KTLKPSVMVV IETEVNLNAP SFANRFIEAL FFYGAFFDCF ETCFKEEEEL KTTMEEVLGM  240
GIDNIVSKEN GERVIRSVRI GVWRAFFERF RMVESKLSDS SLYQASLVAK KFGYGSSLTM  300
ERNGK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-222828879339GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010087232.11e-108hypothetical protein L484_009741
TrEMBLW9QJV01e-108W9QJV0_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17490.15e-39RGA-like protein 3